Glue Balm 15g

$20.00

Type: Clear (no scent)

Clear (no scent)
Peach scent

Payment Options

mastervisapaypalklarnaafterpayzip

Our Glue Balm is a soft, strong-hold formula designed for smooth, effortless lifting. It secures natural lashes onto the shield without stiffness or residue, making your lash lift easier than ever!

HOW TO USE

  • Using a micro brush, apply a thin layer onto the lash shield.
  • (Pro Tip: For extra hold, apply a very thin layer on top of the lashes as well)
  • Gently lift lashes from root to tip and secure them onto the shield.
  • Once lashes are perfectly placed, proceed with your solutions.

INGREDIENTS

Water (Aqua), PVP, Petrolatum, Polysorbate 20, Glycerin, Beeswax, Phenoxyethanol, 1,2-Hexanediol, Hydrolyzed Keratin, Cocos Nucifera (Coconut) Oil, Simmondsia Chinensis (Jojoba) Seed Oil, Helianthus Annuus (Sunflower) Seed Oil, Aloe Barbadensis Leaf Extract.

MADE IN CHINA

Materials

All our lashes are made from the highest quality of a synthetic material known as PBT (Polybutylene Terephthalate), also referred to as faux mink or faux silk lashes. This material is imported from South Korea, then manufactured into our lash products by skilled artisans using a combination of hand and machine processes.

PBT is the gold standard for Lash Artists around the world - both for Artists and for their clients. The lashes made from PBT are extremely soft and lightweight, while maintaining a long-lasting curl. This material is also known to cause significantly less allergic reactions than other eyelash extension materials on the market. 

Our lashes are 100% vegan and cruelty free and manufactured to our high standards of craftsmanship, fair labour practices and environmental considerations. Our lashes are subject to stringent quality controls and regular testing. More information about our values can be found here

Free Returns

The August Lashes standard of service is simple - Only Your Absolute Satisfaction Is Acceptable

As such, we've committed to offering a 45-day period for Free Returns and Exchanges for products to be unused or lightly sampled (less than 25% used). This applies to all products

If you are unable with our products in any way or if you have simply changed your mind, please contact us via Facebook or Instagram to arrange a return/exchange

We welcome all feedback and promise to deal with all issues promptly without wasting your time

See why hundreds of Lash Artists trust August Lashes over and over and over and over again!

Shipping Info

Orders made before 12PM Western Australian time will be fulfilled on the same day. All orders are posted via Express Post with Australia Post

We observe all Australian and Western Australian public holidays. Orders placed after 12PM, on weekends or on public holidays will be fulfilled on the next business day

The following delivery times are based on general observations from most orders:

Location Estimated Delivery Time
Perth Metro 1 Business Day (Next Day)
Other Capital Cities 2 Business Days
Rural Areas Add 1 Business Day
New Zealand 4-7 Business Bays

Please note, whilst we make every effort to fulfil your orders in the above timeframes, actual delivery is subject to Australia Post availabilities and we do not guarantee any delivery timeframes.

Pick-Up
For same day pick-up, orders must be made before 1 PM Perth time (on a business day)
 
Orders can be picked up from our Malaga store during store opening hours, 10am - 4pm, Monday to Friday
Bulk Buy

 

Our Bulk Order discounts are designed to pass cost savings on larger orders and we've designed our discount tiers to suit your business at every stage

Bulk Buy Discounts are applied automatically and do not combine with any other discounts

 

OUR SERVICE GUARANTEES

FAST SHIPPING

Orders before 2pm WST dispatched daily and free Express Post on all orders over $120

VIP SERVICE

Prompt and efficient support that doesn't waste your time. Be amazed by the August Lashes Experience

45 DAY RETURNS

Free returns within 45 days, including change of mind and on slightly sampled products

YOU MAY ALSO LOVE

Have A Question?


No problem! We're always here to help. Just click below for assistance

FAQ CONTACT US